Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NOX3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 223-395 of human NOX3 (NP_056533.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NOX3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 223-395 of human NOX3 (NP_056533.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12137A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NOX3 |
| Target Synonyms | MOX-2; GP91-3; NOX3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, HepG2, Mouse brain, Mouse pancreas, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 223-395 of human NOX3 (NP_056533.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GRIVRGQTQDSLSLHNITFCRDRYAEWQTVAQCPVPQFSGKEPSAWKWILGPVVLYACERIIRFWRFQQEVVITKVVSHPSGVLELHMKKRGFKMAPGQYILVQCPAISSLEWHPFTLTSAPQEDFFSVHIRAAGDWTAALLEAFGAEGQALQEPWSLPRLAVDGPFGTALTD | Uniprot ID | Q9HBY0 |
Uniprot Id
Q9HBY0
Target Species
Human
Target Name
NOX3
Target Full Name
NADPH oxidase 3
Target Function
NADPH oxidase which constitutively produces superoxide upon formation of a complex with CYBA/p22phox. Plays a role in the biogenesis of otoconia/otolith, which are crystalline structures of the inner ear involved in the perception of gravity.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Synonyms
NOX3; MOX2; NADPH oxidase 3; Mitogenic oxidase 2; MOX-2; gp91phox homolog 3; GP91-3
Target Background
This gene encodes a member of the NOX family of NADPH oxidases. These enzymes have the capacity to generate superoxide and other reactive oxygen species (ROS) and transport electrons across the plasma membrane. The ROS generated by family members have been implicated in numerous biological functions including host defense, posttranlational processing of proteins, cellular signaling, regulation of gene expression, and cell differentiation. The protein encoded by this gene is expressed predominantly in the inner ear and is involved in the biogenesis of otoconia/otolith, which are crystalline structures of the inner ear involved in the perception of gravity.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
