Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NOX5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 661-765 of human NOX5 (NP_078781.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against NOX5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 661-765 of human NOX5 (NP_078781.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09369A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NOX5 |
| Target Synonyms | NOX5 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | PC-3 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 661-765 of human NOX5 (NP_078781.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AEEAQYGRFLELHMYMTSALGKNDMKAIGLQMALDLLANKEKKDSITGLQTRTQPGRPDWSKVFQKVAAEKKGKVQVFFCGSPALAKVLKGHCEKFGFRFFQENF | Uniprot ID | Q96PH1 |
Uniprot Id
Q96PH1
Target Species
Human
Target Name
NOX5
Target Full Name
NADPH oxidase 5
Target Function
Calcium-dependent NADPH oxidase that generates superoxide. Also functions as a calcium-dependent proton channel and may regulate redox-dependent processes in lymphocytes and spermatozoa. May play a role in cell growth and apoptosis. Isoform v2 and isoform v5 are involved in endothelial generation of reactive oxygen species (ROS), proliferation and angiogenesis and contribute to endothelial response to thrombin.
Target Subcellular Location
Membrane; Multi-pass membrane protein.; [Isoform v2]: Endoplasmic reticulum.; [Isoform v5]: Endoplasmic reticulum.
Target Tissue Specificity
Mainly expressed in pachytene spermatocytes of testis and in lymphocyte-rich areas of spleen and lymph nodes. Isoform v1 is expressed in spleen. Isoform v2 is expressed in testis. Also detected in ovary, placenta, pancreas, cardiac fibroblasts. Expressed
Target Synonyms
NOX5; NADPH oxidase 5
Target Background
This gene is predominantly expressed in the testis and lymphocyte-rich areas of spleen and lymph nodes. It encodes a calcium-dependen NADPH oxidase that generates superoxide, and functions as a calcium-dependent proton channel that may regulate redox-dependent processes in lymphocytes and spermatozoa. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
