Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NPB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human NPB (NP_683694.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against NPB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human NPB (NP_683694.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-00174A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NPB |
| Target Synonyms | L7; PPL7; PPNPB; NPB | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, SW480 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human NPB (NP_683694.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MARSATLAAAALALCLLLAPPGLAWYKPAAGHSSYSVGRAAGLLSGLRRSPYARRSQPYRGAEPPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANVFLSLRAADCLAA | Uniprot ID | Q8NG41 |
Uniprot Id
Q8NG41
Target Species
Human
Target Name
NPB
Target Full Name
Neuropeptide B
Target Function
May be involved in the regulation of feeding, neuroendocrine system, memory, learning and in the afferent pain pathway.
Target Subcellular Location
Secreted.
Target Protein Families
Neuropeptide B/W family
Target Tissue Specificity
Widely expressed in the central nervous system. High levels are found in substantia nigra, hypothalamus, hyppocampus, spinal cord, placenta and fetal brain; lower levels are found in testis, uterus and ovary. Also detected at high levels in colorectal ade
Target Research Area
Metabolism
Target Synonyms
NPB; PPL7; PPNPB; Neuropeptide B; Preproprotein L7; hPPL7) [Cleaved into: Neuropeptide B-23; NPB23; hL7); Neuropeptide B-29; NPB29; hL7C)]
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
