-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NPHS1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1142-1241 of human NPHS1 (NP_004637.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NPHS1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1142-1241 of human NPHS1 (NP_004637.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06367A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NPHS1 |
| Target Synonyms | CNF; NPHN; nephrin; NPHS1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1142-1241 of human NPHS1 (NP_004637.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LRDFSPQLPPTQEEVSYSRGFTGEDEDMAFPGHLYDEVERTYPPSGAWGPLYDEVQMGPWDLHWPEDTYQDPRGIYDQVAGDLDTLEPDSLPFELRGHLV | Uniprot ID | O60500 |
Uniprot Id
O60500
Target Species
Human
Target Name
NPHS1
Target Full Name
Nephrin
Target Function
Seems to play a role in the development or function of the kidney glomerular filtration barrier. Regulates glomerular vascular permeability. May anchor the podocyte slit diaphragm to the actin cytoskeleton. Plays a role in skeletal muscle formation through regulation of myoblast fusion.
Target Involvement
Nephrotic syndrome 1 (NPHS1)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Protein Families
Immunoglobulin superfamily
Target Tissue Specificity
Specifically expressed in podocytes of kidney glomeruli.
Target Research Area
Cell Adhesion, Signal Transduction
Target Synonyms
CNF ; Nephrin; Nephrosis 1 congenital Finnish type ; Nephrosis 1, congenital, Finnish type (nephrin); NPHN ; NPHN_HUMAN; NPHS 1; Nphs1; Renal glomerulus specific cell adhesion receptor; Renal glomerulus-specific cell adhesion receptor
Target Background
This gene encodes a member of the immunoglobulin family of cell adhesion molecules that functions in the glomerular filtration barrier in the kidney. The gene is primarily expressed in renal tissues, and the protein is a type-1 transmembrane protein found at the slit diaphragm of glomerular podocytes. The slit diaphragm is thought to function as an ultrafilter to exclude albumin and other plasma macromolecules in the formation of urine. Mutations in this gene result in Finnish-type congenital nephrosis 1, characterized by severe proteinuria and loss of the slit diaphragm and foot processes.
Notification