Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NPHS2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-388 of human NPHS2 (NP_055440.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NPHS2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-388 of human NPHS2 (NP_055440.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01729A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NPHS2 |
| Target Synonyms | PDCN; SRN1; NPHS2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NTERA-2, Rat spleen | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-388 of human NPHS2 (NP_055440.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPSTVVLPLPFDLLNCLSSPSNRTQGSLPFPSPSKPVEPLNPKKKDSPML | Uniprot ID | Q9NP85 |
Uniprot Id
Q9NP85
Target Species
Human
Target Name
NPHS2
Target Full Name
Podocin
Target Function
Plays a role in the regulation of glomerular permeability, acting probably as a linker between the plasma membrane and the cytoskeleton.
Target Involvement
Nephrotic syndrome 2 (NPHS2)
Target Subcellular Location
[Isoform 1]: Cell membrane; Peripheral membrane protein.; [Isoform 2]: Endoplasmic reticulum.
Target Protein Families
Band 7/mec-2 family
Target Tissue Specificity
Almost exclusively expressed in the podocytes of fetal and mature kidney glomeruli.
Target Research Area
Cell Biology
Target Synonyms
nephrosis 2; Nephrosis 2, idiopathic, steroid resistant (podocin); nephrosis 2, idiopathic, steroid resistant; NPHS2; NPHS2 gene; PDCN; PODO_HUMAN; Podocin; SRN1
Target Background
This gene encodes a protein that plays a role in the regulation of glomerular permeability. Mutations in this gene cause steroid-resistant nephrotic syndrome. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
