Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NPM3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-140 of human NPM3 (NP_008924.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NPM3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-140 of human NPM3 (NP_008924.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06971A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NPM3 |
| Target Synonyms | PORMIN; TMEM123; NPM3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 30-140 of human NPM3 (NP_008924.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | APVTMDSFFFGCELSGHTRSFTFKVEEEDDAEHVLALTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIV | Uniprot ID | O75607 |
Uniprot Id
O75607
Target Species
Human
Target Name
NPM3
Target Full Name
Nucleoplasmin-3
Target Function
Plays a role in the regulation of diverse cellular processes such as ribosome biogenesis, chromatin remodeling or protein chaperoning. Modulates the histone chaperone function and the RNA-binding activity of nucleolar phosphoprotein B23/NPM. Efficiently mediates chromatin remodeling when included in a pentamer containing NPM3 and NPM.
Target Subcellular Location
Nucleus. Nucleus, nucleolus.
Target Protein Families
Nucleoplasmin family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
NPM 3; NPM3; NPM3_HUMAN; Nub1; nucleophosmin/nucleoplasmin family, member 3; nucleophosmin/nucleoplasmin, 3; Nucleoplasmin 3; Nucleoplasmin-3; PORMIN; RGD1565542; TMEM123
Target Background
The protein encoded by this gene is related to the nuclear chaperone phosphoproteins, nucleoplasmin and nucleophosmin. This protein is strongly expressed in diverse cell types where it localizes primarily to the nucleus. Based on its similarity to nucleoplasmin and nucleophosmin, this protein likely functions as a molecular chaperone in the cell nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
