-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NPSR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human NPSR1 (NP_001287863.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NPSR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human NPSR1 (NP_001287863.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00171A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NPSR1 |
| Target Synonyms | GPRA; NPSR; VRR1; ASRT2; PGR14; GPR154; NPSR1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HT-29 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human NPSR1 (NP_001287863.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SKAKIKAIKYSIIIILAFICCWSPYFLFDILDNFNLLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCREQRSQDSRMTFRERTERHEMQILSKPEFI | Uniprot ID | Q6W5P4 |
Uniprot Id
Q6W5P4
Target Species
Human
Target Name
NPSR1
Target Full Name
Neuropeptide S receptor
Target Function
G-protein coupled receptor for neuropeptide S (NPS). Promotes mobilization of intracellular Ca(2+) stores. Inhibits cell growth in response to NPS binding. Involved in pathogenesis of asthma and other IgE-mediated diseases.
Target Involvement
Asthma-related traits 2 (ASRT2)
Target Subcellular Location
[Isoform 1]: Cell membrane; Multi-pass membrane protein.; [Isoform 3]: Cell membrane; Multi-pass membrane protein.; [Isoform 4]: Cell membrane; Multi-pass membrane protein.; [Isoform 2]: Cytoplasm.; [Isoform 5]: Cytoplasm.; [Isoform 6]: Cytoplasm.; [Isoform 7]: Cytoplasm.; [Isoform 9]: Cytoplasm.
Target Protein Families
G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily
Target Tissue Specificity
Isoform 4 is ubiquitous; it is detected in glandular epithelia of bronchus, stomach, small intestine, colon, uterus, esophagus, spleen, kidney, pancreas, prostate and breast. Isoform 1 is detected in uterus, colon and prostate, and in the smooth muscle ce
Target Synonyms
NPSR1; GPR154; GPRA; PGR14; Neuropeptide S receptor; G-protein coupled receptor 154; G-protein coupled receptor PGR14; G-protein coupled receptor for asthma susceptibility
Target Background
This gene encodes a member of the vasopressin/oxytocin subfamily of G protein-coupled receptors. The encoded membrane protein acts as a receptor for neuropeptide S and affects a variety of cellular processes through its signaling. Increased expression of this gene in ciliated cells of the respiratory epithelium and in bronchial smooth muscle cells is associated with asthma. Polymorphisms in this gene have also been associated with asthma susceptibility, panic disorders, inflammatory bowel disease, and rheumatoid arthritis. Alternative splicing results in multiple transcript variants.
Notification