-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NR2F6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-55 of human NR2F6 (NP_005225.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NR2F6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-55 of human NR2F6 (NP_005225.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05171A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NR2F6 |
| Target Synonyms | EAR2; EAR-2; ERBAL2; NR2F6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-55 of human NR2F6 (NP_005225.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVD | Uniprot ID | P10588 |
Uniprot Id
P10588
Target Species
Human
Target Name
NR2F6
Target Full Name
Nuclear receptor subfamily 2 group F member 6
Target Function
Transcription factor predominantly involved in transcriptional repression. Binds to promoter/enhancer response elements that contain the imperfect 5'-AGGTCA-3' direct or inverted repeats with various spacings which are also recognized by other nuclear hormone receptors. Involved in modulation of hormonal responses. Represses transcriptional activity of the lutropin-choriogonadotropic hormone receptor/LHCGR gene, the renin/REN gene and the oxytocin-neurophysin/OXT gene. Represses the triiodothyronine-dependent and -independent transcriptional activity of the thyroid hormone receptor gene in a cell type-specific manner. The corepressing function towards thyroid hormone receptor beta/THRB involves at least in part the inhibition of THRB binding to triiodothyronine response elements (TREs) by NR2F6. Inhibits NFATC transcription factor DNA binding and subsequently its transcriptional activity. Acts as transcriptional repressor of IL-17 expression in Th-17 differentiated CD4(+) T cells and may be involved in induction and/or maintenance of peripheral immunological tolerance and autoimmunity. Involved in development of forebrain circadian clock; is required early in the development of the locus coeruleus (LC).
Target Subcellular Location
Nucleus.
Target Protein Families
Nuclear hormone receptor family, NR2 subfamily
Target Tissue Specificity
Expressed in heart, placenta, liver, skeletal muscle, kidney and pancreas.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
EAR 2; EAR-2; EAR2; ERBA RELATED 2; ERBA related gene 2; ERBAL2; Nr2f6; NR2F6_HUMAN; Nuclear receptor subfamily 2 group F member 6; Orphan nuclear receptor EAR2 (V erbA related protein EAR 2); v erb a avian erythroblastic leukemia viral oncogene homolog like; V erbA related protein EAR 2; V-erbA-related protein 2
Target Background
Enables DNA-binding transcription factor activity and sequence-specific double-stranded DNA binding activity. Involved in negative regulation of transcription by RNA polymerase II. Located in nucleus.
Notification