Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NRARP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-114 of human NRARP (NP_001004354.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NRARP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-114 of human NRARP (NP_001004354.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03303A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NRARP |
| Target Synonyms | NRARP | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-114 of human NRARP (NP_001004354.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYAASGR | Uniprot ID | Q7Z6K4 |
Uniprot Id
Q7Z6K4
Target Species
Human
Target Name
NRARP
Target Full Name
Notch-regulated ankyrin repeat-containing protein
Target Function
Downstream effector of Notch signaling. Involved in the regulation of liver cancer cells self-renewal. Involved in angiogenesis acting downstream of Notch at branch points to regulate vascular density. Proposed to integrate endothelial Notch and Wnt signaling to control stalk cell proliferation and to stablilize new endothelial connections during angiogenesis. During somitogenesis involved in maintenance of proper somite segmentation and proper numbers of somites and vertebrae. Required for proper anterior-posterior somite patterning. Proposed to function in a negative feedback loop to destabilize Notch 1 intracellular domain (NICD) and downregulate the Notch signal, preventing expansion of the Notch signal into the anterior somite domain.
Target Protein Families
NRARP family
Target Synonyms
MGC61598; Notch regulated ankyrin repeat containing protein; NOTCH regulated ankyrin repeat protein; Notch-regulated ankyrin repeat-containing protein; nrarp; NRARP_HUMAN
Target Background
Involved in Notch signaling pathway. Acts upstream of or within negative regulation of Notch signaling pathway and positive regulation of canonical Wnt signaling pathway.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
