-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NRF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human NRF1 (Q16656) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ChIP, ELISA, CUT&Tag.
The antibody against NRF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human NRF1 (Q16656) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ChIP, ELISA, CUT&Tag.
| Cat.No | ADA-17010A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NRF1 |
| Target Synonyms | ALPHA-PAL; NRF1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, 293T, HepG2, Mouse lung, Rat testis | Application | ELISA, WB, ChIP, CUT&Tag, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human NRF1 (Q16656). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LVPSQTVVQTFSNPDGTVSLIQVGTGATVATLADASELPTTVTVAQVNYSAVADGEVEQNWATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQQGA | Uniprot ID | Q16656 |
Uniprot Id
Q16656
Target Species
Human
Target Name
NRF1
Target Full Name
Nuclear respiratory factor 1
Target Function
Transcription factor that activates the expression of the EIF2S1 (EIF2-alpha) gene. Links the transcriptional modulation of key metabolic genes to cellular growth and development. Implicated in the control of nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication.
Target Subcellular Location
Nucleus.
Target Protein Families
NRF1/Ewg family
Target Tissue Specificity
Ubiquitously expressed with strongest expression in skeletal muscle.
Target Synonyms
alpha pal; alpha palindromic binding protein; Alpha palindromic-binding protein; Alpha-pal; locus control region factor 1; NFE2 related factor 1; NRF-1; Nrf1; NRF1_HUMAN; Nuclear respiratory factor 1
Target Background
This gene encodes a protein that homodimerizes and functions as a transcription factor which activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth. Alternative splicing results in multiple transcript variants. Confusion has occurred in bibliographic databases due to the shared symbol of NRF1 for this gene and for "nuclear factor (erythroid-derived 2)-like 1" which has an official symbol of NFE2L1.
Notification