Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NRN1L was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 39-139 of human NRN1L (Q496H8) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NRN1L was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 39-139 of human NRN1L (Q496H8) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00184A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NRN1L |
| Target Synonyms | UNQ2446; cpg15-2; MRCC2446; NRN1L | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF-7, Mouse bone marrow, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 39-139 of human NRN1L (Q496H8). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PNRCDTIYQGFAECLIRLGDSMGRGGELETICRSWNDFHACASQVLSGCPEEAAAVWESLQQEARQAPRPNNLHTLCGAPVHVRERGTGSETNQETLRATA | Uniprot ID | Q496H8 |
Uniprot Id
Q496H8
Target Species
Human
Target Name
NRN1L
Target Full Name
Neuritin-like protein
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Target Protein Families
Neuritin family
Target Synonyms
MRCC2446; Neuritin-like protein; Nrn1l; NRN1L_HUMAN; UNQ2446/PRO5725
Target Background
The protein encoded by this gene is extracellular and enhances both neurite growth and neuronal survival. The encoded protein is found both as a GPI anchored membrane-bound form and as a secreted form. This activity-related ligand functions as a homodimer or heterodimer.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
