Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NRP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-219 of human NRP2 (NP_957718.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against NRP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-219 of human NRP2 (NP_957718.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-12143A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NRP2 |
| Target Synonyms | NP2; NPN2; PRO2714; VEGF165R2; NRP2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 21-219 of human NRP2 (NP_957718.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RGQPDPPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVYAPEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSMLYIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTILAKPKMEIILQFLIFDLEHDPLQVGEGDCKYDWLDIWDGI | Uniprot ID | O60462 |
Uniprot Id
O60462
Target Species
Human
Target Name
NRP2
Target Full Name
Neuropilin-2
Target Function
High affinity receptor for semaphorins 3C, 3F, VEGF-165 and VEGF-145 isoforms of VEGF, and the PLGF-2 isoform of PGF.; (Microbial infection) Acts as a receptor for human cytomegalovirus pentamer-dependent entry in epithelial and endothelial cells.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.; [Isoform s9]: Secreted.
Target Protein Families
Neuropilin family
Target Synonyms
MGC126574; Neuropilin 2; Neuropilin-2; Neuropilin2; NP 2; NP2 ; NPN 2; NPN2; NRP 2; Nrp2; NRP2_HUMAN; PRO2714 ; Receptor for VEGF165 and semaphorins class3; Vascular endothelial cell growth factor 165 receptor 2; Vascular endothelial growth factor 165 receptor 2; VEGF1265R2; VEGF165R2
Target Background
This gene encodes a member of the neuropilin family of receptor proteins. The encoded transmembrane protein binds to SEMA3C protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3C} and SEMA3F protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3F}, and interacts with vascular endothelial growth factor (VEGF). This protein may play a role in cardiovascular development, axon guidance, and tumorigenesis. This protein has also been determined to act as a co-receptor for SARS-CoV-2 (which causes COVID-19) to infect host cells.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
