-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NSUN2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 617-708 of human NSUN2 (NP_060225.4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against NSUN2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 617-708 of human NSUN2 (NP_060225.4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-15673A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NSUN2 |
| Target Synonyms | MISU; MRT5; SAKI; TRM4; NSUN2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 617-708 of human NSUN2 (NP_060225.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLKYEPDSANPDALQCPIVLCGWRGKASIRTFVPKNERLHYLRMMGLEVLG | Uniprot ID | Q08J23 |
Uniprot Id
Q08J23
Target Species
Human
Target Name
NSUN2
Target Full Name
RNA cytosine C(5)-methyltransferase NSUN2
Target Function
RNA cytosine C(5)-methyltransferase that methylates cytosine to 5-methylcytosine (m5C) in various RNAs, such as tRNAs, mRNAs and some long non-coding RNAs (lncRNAs). Involved in various processes, such as epidermal stem cell differentiation, testis differentiation and maternal to zygotic transition during early development: acts by increasing protein synthesis; cytosine C(5)-methylation promoting tRNA stability and preventing mRNA decay. Methylates cytosine to 5-methylcytosine (m5C) at positions 34 and 48 of intron-containing tRNA(Leu)(CAA) precursors, and at positions 48, 49 and 50 of tRNA(Gly)(GCC) precursors. tRNA methylation is required generation of RNA fragments derived from tRNAs (tRFs). Also mediates C(5)-methylation of mitochondrial tRNAs. Catalyzes cytosine C(5)-methylation of mRNAs, leading to stabilize them and prevent mRNA decay: mRNA stabilization involves YBX1 that specifically recognizes and binds m5C-modified transcripts. Cytosine C(5)-methylation of mRNAs also regulates mRNA export: methylated transcripts are specifically recognized by THOC4/ALYREF, which mediates mRNA nucleo-cytoplasmic shuttling. Also mediates cytosine C(5)-methylation of non-coding RNAs, such as vault RNAs (vtRNAs), promoting their processing into regulatory small RNAs. Cytosine C(5)-methylation of vtRNA VTRNA1.1 promotes its processing into small-vault RNA4 (svRNA4) and regulates epidermal differentiation. May act downstream of Myc to regulate epidermal cell growth and proliferation. Required for proper spindle assembly and chromosome segregation, independently of its methyltransferase activity.
Target Involvement
Mental retardation, autosomal recessive 5 (MRT5)
Target Subcellular Location
Nucleus, nucleolus. Cytoplasm. Mitochondrion. Cytoplasm, cytoskeleton, spindle. Secreted, extracellular exosome.
Target Protein Families
Class I-like SAM-binding methyltransferase superfamily, RsmB/NOP family, TRM4 subfamily
Target Tissue Specificity
Expressed in adult and fetal brain and in lymphoblastoid cells.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
Myc-induced SUN domain-containing protein;Misu;NOL1/NOP2/Sun domain family member 2;Substrate of AIM1/Aurora kinase B;mRNA cytosine C5;tRNA cytosine C5;tRNA methyltransferase 4 homolog;hTrm4
Target Background
This gene encodes a methyltransferase that catalyzes the methylation of cytosine to 5-methylcytosine (m5C) at position 34 of intron-containing tRNA(Leu)(CAA) precursors. This modification is necessary to stabilize the anticodon-codon pairing and correctly translate the mRNA. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
Notification