Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NT5C2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 382-561 of human NT5C2 (NP_036361.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NT5C2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 382-561 of human NT5C2 (NP_036361.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01994A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NT5C2 |
| Target Synonyms | GMP; NT5B; PNT5; SPG45; SPG65; cN-II; NT5C2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, DU145, HT-29, Rat testis, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 382-561 of human NT5C2 (NP_036361.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | WTDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYAASFINLLYYPFSYLFRAAHVLMPHESTVEHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNLFPLAPQEITHCHDEDDDEEEEEEEE | Uniprot ID | P49902 |
Uniprot Id
P49902
Target Species
Human
Target Name
NT5C2
Target Full Name
Cytosolic purine 5'-nucleotidase
Target Function
May have a critical role in the maintenance of a constant composition of intracellular purine/pyrimidine nucleotides in cooperation with other nucleotidases. Preferentially hydrolyzes inosine 5'-monophosphate (IMP) and other purine nucleotides.
Target Involvement
Spastic paraplegia 45, autosomal recessive (SPG45)
Target Subcellular Location
Cytoplasm.
Target Protein Families
5'(3')-deoxyribonucleotidase family
Target Synonyms
GMP; NT5B; PNT5; SPG45; SPG65; cN-II; NT5C2
Target Background
This gene encodes a hydrolase that serves as an important role in cellular purine metabolism by acting primarily on inosine 5'-monophosphate and other purine nucleotides.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
