-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NTN1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-600 of human NTN1 (NP_004813.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NTN1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-600 of human NTN1 (NP_004813.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08709A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NTN1 |
| Target Synonyms | NET1; MRMV4; NTN1L; NTN1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, HT-29 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 500-600 of human NTN1 (NP_004813.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HILKADKAGDWWKFTVNIISVYKQGTSRIRRGDQSLWIRSRDIACKCPKIKPLKKYLLLGNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGK | Uniprot ID | O95631 |
Uniprot Id
O95631
Target Species
Human
Target Name
NTN1
Target Full Name
Netrin-1
Target Function
Netrins control guidance of CNS commissural axons and peripheral motor axons. Its association with either DCC or some UNC5 receptors will lead to axon attraction or repulsion, respectively. Binding to UNC5C might cause dissociation of UNC5C from polymerized TUBB3 in microtubules and thereby lead to increased microtubule dynamics and axon repulsion. Involved in dorsal root ganglion axon projection towards the spinal cord. It also serves as a survival factor via its association with its receptors which prevent the initiation of apoptosis. Involved in tumorigenesis by regulating apoptosis.
Target Subcellular Location
Secreted. Cytoplasm.
Target Tissue Specificity
Widely expressed in normal adult tissues with highest levels in heart, small intestine, colon, liver and prostate. Reduced expression in brain tumors and neuroblastomas. Expressed in epididymis (at protein level).
Target Synonyms
epididymis tissue protein Li 131P; NET1_HUMAN; Netrin 1, mouse, homolog of; Netrin 1-like; Netrin-1; Netrin1; Ntn 1; NTN 1L; NTN1; NTN1L; Unc6
Target Background
Netrin is included in a family of laminin-related secreted proteins. The function of this gene has not yet been defined; however, netrin is thought to be involved in axon guidance and cell migration during development. Mutations and loss of expression of netrin suggest that variation in netrin may be involved in cancer development.
Notification