Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NUAK2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 479-628 of human NUAK2(NP_112214.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC.
The antibody against NUAK2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 479-628 of human NUAK2(NP_112214.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC.
Immunofluorescence analysis of A-549 cells using NUAK2 Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Cat.No | ADA-08386A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NUAK2 |
| Target Synonyms | NUAK2; SNARK; NUAK family kinase 2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 479-628 of human NUAK2(NP_112214.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VSGDPKEQKPPQASGLLLHRKGILKLNGKFSQTALELAAPTTFGSLDELAPPRPLARASRPSGAVSEDSILSSESFDQLDLPERLPEPPLRGCVSVDNLTGLEEPPSEGPGSCLRRWRQDPLGDSCFSLTDCQEVTATYRQALRVCSKLT | Uniprot ID | Q9H093 |
Uniprot Id
Q9H093
Target Species
Human
Target Name
NUAK2
Target Full Name
NUAK family SNF1-like kinase 2
Target Function
Stress-activated kinase involved in tolerance to glucose starvation. Induces cell-cell detachment by increasing F-actin conversion to G-actin. Expression is induced by CD95 or TNF-alpha, via NF-kappa-B. Protects cells from CD95-mediated apoptosis and is required for the increased motility and invasiveness of CD95-activated tumor cells. Able to phosphorylate 'Ser-464' of LATS1.
Target Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family, SNF1 subfamily
Target Synonyms
DKFZp434J037; DKFZp686F01113; FLJ90349; NUAK family SNF1 like kinase 2; NUAK family SNF1-like kinase 2; Nuak2; NUAK2_HUMAN; Omphalocele kinase 2; SNARK; SNF1/AMP activated protein kinase ; SNF1/AMP kinase related kinase; SNF1/AMP kinase-related kinase
Target Background
Enables ATP binding activity; magnesium ion binding activity; and protein serine/threonine kinase activity. Involved in several processes, including cellular response to glucose starvation; negative regulation of apoptotic process; and protein phosphorylation. Predicted to be active in cytoplasm. Implicated in anencephaly.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
