Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NUBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 201-320 of human NUBP1 (NP_002475.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against NUBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 201-320 of human NUBP1 (NP_002475.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-00308A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NUBP1 |
| Target Synonyms | NBP; NBP1; CIAO5; NBP35; NUBP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 201-320 of human NUBP1 (NP_002475.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PQEVSLQDVRKEINFCRKVKLPIIGVVENMSGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS | Uniprot ID | P53384 |
Uniprot Id
P53384
Target Species
Human
Target Name
NUBP1
Target Full Name
Cytosolic Fe-S cluster assembly factor NUBP1
Target Function
Component of the cytosolic iron-sulfur (Fe/S) protein assembly (CIA) machinery. Required for maturation of extramitochondrial Fe-S proteins. The NUBP1-NUBP2 heterotetramer forms a Fe-S scaffold complex, mediating the de novo assembly of an Fe-S cluster and its transfer to target apoproteins. Implicated in the regulation of centrosome duplication. Negatively regulates cilium formation and structure.
Target Subcellular Location
Cytoplasm. Nucleus. Cell projection. Cytoplasm, cytoskeleton, cilium axoneme. Cytoplasm, cytoskeleton, cilium basal body. Cytoplasm, cytoskeleton, microtubule organizing center. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.
Target Protein Families
Mrp/NBP35 ATP-binding proteins family, NUBP1/NBP35 subfamily
Target Synonyms
MGC130052; Cytosolic Fe S cluster assembly factor NUBP1; Cytosolic Fe-S cluster assembly factor NUBP1; MGC117406; MGC130053; NBP 1; NBP; NBP1; NBP35; nubp1; NUBP1_HUMAN; Nucleotide binding protein (e.coli MinD like); Nucleotide binding protein 1 (E.coli MinD like); Nucleotide binding protein 1 (MinD homolog, E. coli); Nucleotide binding protein 1; Nucleotide-binding protein 1
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
