Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NUCKS1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human NUCKS1 (NP_073568.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NUCKS1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human NUCKS1 (NP_073568.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10351A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NUCKS1 |
| Target Synonyms | JC7; NUCKS; NUCKS1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, HepG2, Mouse lung, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human NUCKS1 (NP_073568.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ASKQREMLMEDVGSEEEQEEEDEAPFQEKDSGSDEDFLMEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVGRPTASKASKE | Uniprot ID | Q9H1E3 |
Uniprot Id
Q9H1E3
Target Species
Human
Target Name
NUCKS1
Target Full Name
Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1
Target Function
Chromatin-associated protein involved in DNA repair by promoting homologous recombination (HR). Binds double-stranded DNA (dsDNA) and secondary DNA structures, such as D-loop structures, but with less affinity than RAD51AP1.
Target Subcellular Location
Nucleus. Chromosome.
Target Tissue Specificity
Widely expressed, with highest levels in thyroid gland, prostate and uterus and in fetal liver, thymus and lung.
Target Synonyms
FLJ21480; FLJ32016; FLJ38536; JC7; NUCKS 1; NUCKS; NUCKS_HUMAN; Nucks1; Nuclear casein kinase and cyclin dependent kinase substrate 1; Nuclear ubiquitous casein and cyclin dependent kinases substrate; Nuclear ubiquitous casein and cyclin-dependent kinases substrate; Nuclear ubiquitous casein kinase and cyclin dependent kinase substrate; P1; Potential LAG1 interactor
Target Background
This gene encodes a nuclear protein that is highly conserved in vertebrates. The conserved regions of the protein contain several consensus phosphorylation sites for casein kinase II and cyclin-dependent kinases, two putative nuclear localization signals, and a basic DNA-binding domain. It is phosphorylated in vivo by Cdk1 during mitosis of the cell cycle.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
