-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NUDT16 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-130 of human NUDT16 (NP_689608.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NUDT16 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-130 of human NUDT16 (NP_689608.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10526A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NUDT16 |
| Target Synonyms | NUDT16 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-549 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 60-130 of human NUDT16 (NP_689608.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GFVDTQDRSLEDGLNRELREELGEAAAAFRVERTDYRSSHVGSGPRVVAHFYAKRLTLEELLAVEAGATRA | Uniprot ID | Q96DE0 |
Uniprot Id
Q96DE0
Target Species
Human
Target Name
NUDT16
Target Full Name
U8 snoRNA-decapping enzyme
Target Function
RNA-binding and decapping enzyme that catalyzes the cleavage of the cap structure of snoRNAs and mRNAs in a metal-dependent manner. Part of the U8 snoRNP complex that is required for the accumulation of mature 5.8S and 28S rRNA. Has diphosphatase activity and removes m7G and/or m227G caps from U8 snoRNA and leaves a 5'monophosphate on the RNA. Catalyzes also the cleavage of the cap structure on mRNAs. Does not hydrolyze cap analog structures like 7-methylguanosine nucleoside triphosphate (m7GpppG). Also hydrolysis m7G- and m227G U3-capped RNAs but with less efficiencies. Has broad substrate specificity with manganese or cobalt as cofactor and can act on various RNA species. Binds to the U8 snoRNA; metal is not required for RNA-binding. May play a role in the regulation of snoRNAs and mRNAs degradation. Acts also as a phosphatase; hydrolyzes the non-canonical purine nucleotides inosine diphosphate (IDP) and deoxyinosine diphosphate (dITP) as well as guanosine diphosphate (GDP), deoxyguanosine diphosphate (dGDP), xanthine diphosphate (XDP), inosine triphosphate (ITP) and deoxyinosine triphosphate (ITP) to their respective monophosphate derivatives and does not distinguish between the deoxy- and ribose forms. The order of activity with different substrates is IDP > dIDP >> GDP = dGDP > XDP = ITP = dITP. Binds strongly to GTP, ITP and XTP. Participates in the hydrolysis of dIDP/IDP and probably excludes non-canonical purines from RNA and DNA precursor pools, thus preventing their incorporation into RNA and DNA and avoiding chromosomal lesions. Exhibits decapping activity towards NAD-capped RNAs and FAD-capped RNAs. Exhibits decapping activity towards dpCoA-capped RNAs in vitro.
Target Subcellular Location
Nucleus. Nucleus, nucleoplasm. Nucleus, nucleolus. Cytoplasm.
Target Protein Families
Nudix hydrolase family, NUDT16 subfamily
Target Tissue Specificity
Expressed strongly in lung, kidney, adrenal gland, testis, heart and brain.
Target Synonyms
FLJ31265; FLJ34034; FLJ36248; Nucleoside diphosphate-linked moiety X motif 16; NUD16_HUMAN; Nudix (nucleoside diphosphate linked moiety X) type motif 16; Nudix motif 16; NUDT 16; NUDT16; U8 snoRNA-binding protein H29K; U8 snoRNA-decapping enzyme
Target Background
Enables several functions, including RNA binding activity; metal ion binding activity; and purine ribonucleoside triphosphate binding activity. Involved in IDP catabolic process; RNA metabolic process; and positive regulation of cell cycle process. Located in cytoplasm; nucleolus; and nucleoplasm.
Notification