-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NUDT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human NUDT2 (NP_001152.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NUDT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human NUDT2 (NP_001152.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02817A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NUDT2 |
| Target Synonyms | APAH1; IDDPN; NUDT2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Rat heart, HL-60, Mouse brain, Mouse liver, Rat kidney, SKOV3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human NUDT2 (NP_001152.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA | Uniprot ID | P50583 |
Uniprot Id
P50583
Target Species
Human
Target Name
NUDT2
Target Full Name
Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
Target Function
Catalyzes the asymmetric hydrolysis of diadenosine 5',5'''-P1,P4-tetraphosphate (Ap4A) to yield AMP and ATP. Exhibits decapping activity towards FAD-capped RNAs and dpCoA-capped RNAs in vitro.
Target Protein Families
Nudix hydrolase family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
2310051L06Rik; 5''''-P1; AA939917; Ap4A hydrolase 1; Ap4A hydrolase; AP4A_HUMAN; Ap4Aase; APAH 1; APAH1; Bis(5' nucleosyl) tetraphosphatase [asymmetrical]; Bis(5''-nucleosyl)-tetraphosphatase [asymmetrical]; Diadenosine 5''; Diadenosine 5',5''' P1,P4 tetraphosphate asymmetrical hydrolase; Diadenosine 5',5''-P1,P4-tetraphosphate pyrophosphohydrolase; Diadenosine tetraphosphatase; EC 3.6.1.17; MGC10404; Nucleoside diphosphate linked moiety X motif 2; Nucleoside diphosphate-linked moiety X motif 2; nudix (nucleoside diphosphate linked moiety X)-type motif 2; Nudix motif 2; Nudix-type motif 2; NUDT 2; NUDT2; OTTHUMP00000021256; OTTHUMP00000021257; OTTHUMP00000021258; OTTHUMP00000021259; P4-tetraphosphate asymmetrical hydrolase
Target Background
This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. Alternative splicing has been observed at this locus and four transcript variants, all encoding the same protein, have been identified.
Notification