-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NUDT5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human NUDT5 (Q9UKK9) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against NUDT5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human NUDT5 (Q9UKK9) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14447A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NUDT5 |
| Target Synonyms | YSA1; YSA1H; YSAH1; hNUDT5; NUDT5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-431, HepG2, Mouse liver, Mouse thymus, Rat kidney | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NUDT5 (Q9UKK9). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLID | Uniprot ID | Q9UKK9 |
Uniprot Id
Q9UKK9
Target Species
Human
Target Name
NUDT5
Target Full Name
ADP-sugar pyrophosphatase
Target Function
Enzyme that can either act as an ADP-sugar pyrophosphatase in absence of diphosphate or catalyze the synthesis of ATP in presence of diphosphate. In absence of diphosphate, hydrolyzes with similar activities various modified nucleoside diphosphates such as ADP-ribose, ADP-mannose, ADP-glucose, 8-oxo-GDP and 8-oxo-dGDP. Can also hydrolyze other nucleotide sugars with low activity. In presence of diphosphate, mediates the synthesis of ATP in the nucleus by catalyzing the conversion of ADP-ribose to ATP and ribose 5-phosphate. Nuclear ATP synthesis takes place when dephosphorylated at Thr-45. Nuclear ATP generation is required for extensive chromatin remodeling events that are energy-consuming. Does not play a role in U8 snoRNA decapping activity. Binds U8 snoRNA.
Target Subcellular Location
Nucleus.
Target Protein Families
Nudix hydrolase family
Target Tissue Specificity
Widely expressed. Most abundant in liver.
Target Synonyms
ADP sugar pyrophosphatase; ADP-sugar pyrophosphatase; hYSAH 1; hYSAH1; Nucleoside diphosphate linked moiety X motif 5; Nucleoside diphosphate linked moiety X type motif 5; Nucleoside diphosphate-linked moiety X motif 5; Nudix (nucleoside diphosphate linked moiety X) type motif 5; Nudix motif 5; Nudix type motif 5; NUDT 5; Nudt5; NUDT5_HUMAN; YSA1; YSA1H
Target Background
This gene belongs to the Nudix (nucleoside diphosphate linked moiety X) hydrolase superfamily. The encoded enzyme catalyzes the hydrolysis of modified nucleoside diphosphates, including ADP-ribose (ADPR) and 8-oxoGua-containing 8-oxo-dADP and 8-oxo-dGDP. Protein-bound ADP ribose can be hazardous to the cell because it can modify some amino acid residues, resulting in the inhibition of ATP-activated potassium channels. 8-oxoGua is an oxidized form of guanine that can potentially alter genetic information by pairing with adenine and cytosine in RNA. Presence of 8-oxoGua in RNA results in formation of abnormal proteins due to translational errors.
Notification