-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NUP153 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human NUP153 (P49790) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against NUP153 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human NUP153 (P49790) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14147A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NUP153 |
| Target Synonyms | N153; HNUP153; NUP153 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, K-562, Mouse testis | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NUP153 (P49790). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASGAGGVGGGGGGKIRTRRCHQGPIKPYQQGRQQHQGILSRVTESVKNIVPGWLQRYFNKNEDVCSCSTDTSEVPRWPENKEDHLVYADEESSNITDGR | Uniprot ID | P49790 |
Uniprot Id
P49790
Target Species
Human
Target Name
NUP153
Target Full Name
Nuclear pore complex protein Nup153
Target Function
Component of the nuclear pore complex (NPC), a complex required for the trafficking across the nuclear envelope. Functions as a scaffolding element in the nuclear phase of the NPC essential for normal nucleocytoplasmic transport of proteins and mRNAs. Involved in the quality control and retention of unspliced mRNAs in the nucleus; in association with TPR, regulates the nuclear export of unspliced mRNA species bearing constitutive transport element (CTE) in a NXF1- and KHDRBS1-independent manner. Mediates TPR anchoring to the nuclear membrane at NPC. The repeat-containing domain may be involved in anchoring other components of the NPC to the pore membrane. Possible DNA-binding subunit of the nuclear pore complex (NPC).; (Microbial infection) Binds HIV-1 capsid-nucleocapsid (HIV-1 CA-NC) complexes and thereby promotes the integration of the virus in the nucleus of non-dividing cells (in vitro).; (Microbial infection) Binds HIV-2 protein vpx and thereby promotes the nuclear translocation of the lentiviral genome (in vitro).
Target Subcellular Location
Nucleus. Nucleus membrane. Nucleus, nuclear pore complex.
Target Protein Families
NUP153 family
Target Research Area
Immunology
Target Synonyms
153 kDa nucleoporin; HNUP153; N153; NU153_HUMAN; Nuclear pore complex protein hnup153; Nuclear pore complex protein Nup153; Nucleoporin 153kDa; Nucleoporin Nup153; Nup 153; Nup153
Target Background
Nuclear pore complexes regulate the transport of macromolecules between the nucleus and cytoplasm. They are composed of at least 100 different polypeptide subunits, many of which belong to the nucleoporin family. Nucleoporins are glycoproteins found in nuclear pores and contain characteristic pentapeptide XFXFG repeats as well as O-linked N-acetylglucosamine residues oriented towards the cytoplasm. The protein encoded by this gene has three distinct domains: a N-terminal region containing a pore targeting and an RNA-binding domain domain, a central region containing multiple zinc finger motifs, and a C-terminal region containing multiple XFXFG repeats. Alternative splicing results in multiple transcript variants of this gene.
Notification