-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NUP155 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 901-1050 of human NUP155 (NP_705618.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NUP155 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 901-1050 of human NUP155 (NP_705618.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14600A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NUP155 |
| Target Synonyms | N155; ATFB15; NUP155 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, Jurkat, Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 901-1050 of human NUP155 (NP_705618.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LKEYQKISNQVDLSNVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDIVGLQAFQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHHFEQMLKLSQRSKDELFSIALYNWLIQVDLAD | Uniprot ID | O75694 |
Uniprot Id
O75694
Target Species
Human
Target Name
NUP155
Target Full Name
Nuclear pore complex protein Nup155
Target Function
Essential component of nuclear pore complex. Could be essessential for embryogenesis. Nucleoporins may be involved both in binding and translocating proteins during nucleocytoplasmic transport.
Target Involvement
Atrial fibrillation, familial, 15 (ATFB15)
Target Subcellular Location
Nucleus, nuclear pore complex. Nucleus membrane; Peripheral membrane protein; Cytoplasmic side. Nucleus membrane; Peripheral membrane protein; Nucleoplasmic side.
Target Protein Families
Non-repetitive/WGA-negative nucleoporin family
Target Tissue Specificity
Expressed in all tissues tested, including heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
Target Synonyms
155 kDa nucleoporin; ATFB15; D930027M19Rik; KIAA0791; mKIAA0791; N155; NU155_HUMAN; Nuclear pore complex protein Nup155; nucleoporin 155kD; Nucleoporin Nup155; Nup155
Target Background
Nucleoporins are proteins that play an important role in the assembly and functioning of the nuclear pore complex (NPC) which regulates the movement of macromolecules across the nuclear envelope (NE). The protein encoded by this gene plays a role in the fusion of NE vesicles and formation of the double membrane NE. The protein may also be involved in cardiac physiology and may be associated with the pathogenesis of atrial fibrillation. Alternative splicing results in multiple transcript variants of this gene. A pseudogene associated with this gene is located on chromosome 6.
Notification