Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NUP205 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 10-120 of human NUP205 (NP_055950.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NUP205 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 10-120 of human NUP205 (NP_055950.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07291A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NUP205 |
| Target Synonyms | NPHS13; C7orf14; NUP205 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Jurkat, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 10-120 of human NUP205 (NP_055950.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AASLWGPYKDIWHKVGNALWRRQPEAVHLLDKILKKHKPDFISLFKNPPKNVQQHEKVQKASTEGVAIQGQQGTRLLPEQLIKEAFILSDLFDIGELAAVELLLAGEHQQP | Uniprot ID | Q92621 |
Uniprot Id
Q92621
Target Species
Human
Target Name
NUP205
Target Full Name
Nuclear pore complex protein Nup205
Target Function
Plays a role in the nuclear pore complex (NPC) assembly and/or maintenance. May anchor NUP62 and other nucleoporins, but not NUP153 and TPR, to the NPC.
Target Involvement
Nephrotic syndrome 13 (NPHS13)
Target Subcellular Location
Nucleus membrane; Peripheral membrane protein. Nucleus, nuclear pore complex.
Target Protein Families
NUP186/NUP192/NUP205 family
Target Synonyms
NUP205; C7orf14; KIAA0225; Nuclear pore complex protein Nup205; 205 kDa nucleoporin; Nucleoporin Nup205
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
