Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NUP43 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 150-260 of human NUP43 (NP_942590.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NUP43 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 150-260 of human NUP43 (NP_942590.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04698A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NUP43 |
| Target Synonyms | p42; bA350J20.1; NUP43 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, OVCAR3, Rat spleen, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 150-260 of human NUP43 (NP_942590.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DGRINLFRADHKEAVRTIDNADSSTLHAVTFLRTPEILTVNSIGQLKIWDFRQQGNEPSQILSLTGDRVPLHCVDRHPNQQHVVATGGQDGMLSIWDVRQGTMPVSLLKAH | Uniprot ID | Q8NFH3 |
Uniprot Id
Q8NFH3
Target Species
Human
Target Name
NUP43
Target Full Name
Nucleoporin Nup43
Target Function
Component of the Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex is required for the assembly of a functional NPC. The Nup107-160 subcomplex is also required for normal kinetochore microtubule attachment, mitotic progression and chromosome segregation.
Target Subcellular Location
Chromosome, centromere, kinetochore. Nucleus, nuclear pore complex.
Target Synonyms
NUP43Nucleoporin Nup43; Nup107-160 subcomplex subunit Nup43; p42
Target Background
Bidirectional transport of macromolecules between the cytoplasm and nucleus occurs through nuclear pore complexes (NPCs) embedded in the nuclear envelope. NPCs are composed of subcomplexes, and NUP43 is part of one such subcomplex, Nup107-160 (Loiodice et al., 2004 [PubMed 15146057]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
