-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NUP50 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 340-468 of human NUP50 (NP_009103.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against NUP50 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 340-468 of human NUP50 (NP_009103.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-00987A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NUP50 |
| Target Synonyms | NPAP60; NPAP60L; NUP50 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, Rat testis | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 340-468 of human NUP50 (NP_009103.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ENDEPPKVVVTEVKEEDAFYSKKCKLFYKKDNEFKEKGIGTLHLKPTANQKTQLLVRADTNLGNILLNVLIPPNMPCTRTGKNNVLIVCVPNPPIDEKNATMPVTMLIRVKTSEDADELHKILLEKKDA | Uniprot ID | Q9UKX7 |
Uniprot Id
Q9UKX7
Target Species
Human
Target Name
NUP50
Target Full Name
Nuclear pore complex protein Nup50
Target Function
Component of the nuclear pore complex that has a direct role in nuclear protein import. Actively displaces NLSs from importin-alpha, and facilitates disassembly of the importin-alpha:beta-cargo complex and importin recycling. Interacts with regulatory proteins of cell cycle progression including CDKN1B. This interaction is required for correct intracellular transport and degradation of CDKN1B.
Target Subcellular Location
Nucleus, nuclear pore complex. Nucleus membrane; Peripheral membrane protein; Nucleoplasmic side.
Target Tissue Specificity
Ubiquitous. Highest levels in testis, peripheral blood leukocytes and fetal liver.
Target Synonyms
50 kDa nucleoporin; NPAP60 ; NPAP60L; Nuclear pore associated protein 60L; Nuclear pore complex protein Nup50; Nuclear pore-associated protein 60 kDa-like; Nucleoporin 50; Nucleoporin 50kDa; Nucleoporin Nup50; Nup50; NUP50_HUMAN; PRO1146
Target Background
The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import. Pseudogenes of this gene are found on chromosomes 5, 6, and 14. Two transcript variants encoding different isoforms have been found for this gene.
Notification