Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NXF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human NXF1 (NP_006353.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NXF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human NXF1 (NP_006353.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07173A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NXF1 |
| Target Synonyms | TAP; MEX67; NXF1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, Rat brain, 293T, Mouse lung, Mouse spleen, Rat lung, Rat spleen | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human NXF1 (NP_006353.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ILNELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSG | Uniprot ID | Q9UBU9 |
Uniprot Id
Q9UBU9
Target Species
Human
Target Name
NXF1
Target Full Name
Nuclear RNA export factor 1
Target Function
Involved in the nuclear export of mRNA species bearing retroviral constitutive transport elements (CTE) and in the export of mRNA from the nucleus to the cytoplasm (TAP/NFX1 pathway). The NXF1-NXT1 heterodimer is involved in the export of HSP70 mRNA in conjunction with ALYREF/THOC4 and THOC5 components of the TREX complex. ALYREF/THOC4-bound mRNA is thought to be transferred to the NXF1-NXT1 heterodimer for export. Also involved in nuclear export of m6A-containing mRNAs: interaction between SRSF3 and YTHDC1 facilitates m6A-containing mRNA-binding to both SRSF3 and NXF1, promoting mRNA nuclear export.
Target Subcellular Location
Nucleus. Nucleus, nucleoplasm. Nucleus speckle. Nucleus, nuclear pore complex. Nucleus envelope. Cytoplasm. Cytoplasm, Stress granule.
Target Protein Families
NXF family
Target Tissue Specificity
Expressed ubiquitously.
Target Synonyms
DKFZp667O0311; DmNXF1; MEX67; MEX67, yeast, homolog of; Mex67p; mRNA export factor TAP; Mvb1; Nuclear RNA export factor 1; Nuclear RNA export factor 1 homolog (S. cerevisiae); nxf 1; NXF1; NXF1_HUMAN; Protein small bristles; Sbr; TAP; Tip associating protein; Tip-associated protein; Tip-associating protein
Target Background
This gene is one member of a family of nuclear RNA export factor genes. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. Alternative splicing seems to be a common mechanism in this gene family. The encoded protein of this gene shuttles between the nucleus and the cytoplasm and binds in vivo to poly(A)+ RNA. It is the vertebrate homologue of the yeast protein Mex67p. The encoded protein overcomes the mRNA export block caused by the presence of saturating amounts of CTE (constitutive transport element) RNA of type D retroviruses. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
