Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OAT3 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 32-123 of of human OAT3(NP_004245.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against OAT3 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 32-123 of of human OAT3(NP_004245.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
Immunofluorescence analysis of?PC-3 cells using?OAT3 Rabbit pAb(A25030) at?a?dilution of?1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution.?Blue: DAPI for nuclear staining.
| Cat.No | ADA-08362A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OAT3 |
| Target Synonyms | OAT3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant Protein corresponding to a sequence within amino acids 32-123 of of human OAT3(NP_004245.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ANHNLLQIFTAATPVHHCRPPHNASTGPWVLPMGPNGKPERCLRFVHPPNASLPNDTQRAMEPCLDGWVYNSTKDSIVTEWDLVCNSNKLKE | Uniprot ID | Q8TCC7 |
Uniprot Id
Q8TCC7
Target Species
Human
Target Name
SLC22A8
Target Full Name
Organic anion transporter 3
Target Function
Plays an important role in the excretion/detoxification of endogenous and exogenous organic anions, especially from the brain and kidney. Involved in the transport basolateral of steviol, fexofenadine. Transports benzylpenicillin (PCG), estrone-3-sulfate (E1S), cimetidine (CMD), 2,4-dichloro-phenoxyacetate (2,4-D), p-amino-hippurate (PAH), acyclovir (ACV) and ochratoxin (OTA).
Target Subcellular Location
Basolateral cell membrane; Multi-pass membrane protein.
Target Protein Families
Major facilitator (TC 2.A.1) superfamily, Organic cation transporter (TC 2.A.1.19) family
Target Tissue Specificity
Expressed in kidney.
Target Synonyms
hOAT3; OAT3 ; Organic anion transporter 3; S22A8_HUMAN; SLC22A8; Solute carrier family 22 (organic anion transporter); member 8; Solute carrier family 22 member 8
Target Background
This gene encodes a protein involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
