-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OBSCN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1621-1710 of human OBSCN (NP_443075.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against OBSCN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1621-1710 of human OBSCN (NP_443075.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07195A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OBSCN |
| Target Synonyms | UNC89; RHABDO1; ARHGEF30; OBSCN | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1621-1710 of human OBSCN (NP_443075.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EPKVVFAKEQPAHREVQAEAGASATLSCEVAQAQTEVTWYKDGKKLSSSSKVRVEAVGCTRRLVVQQAGQAEAGEYSCEAGGQQLSFRLQ | Uniprot ID | Q5VST9 |
Uniprot Id
Q5VST9
Target Species
Human
Target Name
OBSCN
Target Full Name
Obscurin
Target Function
Structural component of striated muscles which plays a role in myofibrillogenesis. Probably involved in the assembly of myosin into sarcomeric A bands in striated muscle. Has serine/threonine protein kinase activity and phosphorylates N-cadherin CDH2 and sodium/potassium-transporting ATPase subunit ATP1B1. Binds (via the PH domain) strongly to phosphatidylinositol 3,4-bisphosphate (PtdIns(3,4)P2) and phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2), and to a lesser extent to phosphatidylinositol 3-phosphate (PtdIns(3)P), phosphatidylinositol 4-phosphate (PtdIns(4)P), phosphatidylinositol 5-phosphate (PtdIns(5)P) and phosphatidylinositol 3,4,5-trisphosphate (PtdIns(3,4,5)P3).
Target Involvement
A chromosomal aberration involving OBSCN has been found in Wilms tumor. Translocation t(1;7)(q42;p15) with PTHB1.
Target Subcellular Location
[Isoform 3]: Cytoplasm, myofibril, sarcomere, M line. Cytoplasm, myofibril, sarcomere, Z line.
Target Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family
Target Synonyms
BC046431; Gm878; KIAA1556; KIAA1639; OBSCN; OBSCN_HUMAN; Obscurin; Obscurin-MLCK; Obscurin-myosin light chain kinase; Obscurin-RhoGEF; OTTMUSG00000005786; UNC89
Target Background
The obscurin gene spans more than 150 kb, contains over 80 exons and encodes a protein of approximately 720 kDa. The encoded protein contains 68 Ig domains, 2 fibronectin domains, 1 calcium/calmodulin-binding domain, 1 RhoGEF domain with an associated PH domain, and 2 serine-threonine kinase domains. This protein belongs to the family of giant sacromeric signaling proteins that includes titin and nebulin, and may have a role in the organization of myofibrils during assembly and may mediate interactions between the sarcoplasmic reticulum and myofibrils. Alternatively spliced transcript variants encoding different isoforms have been identified.
Notification