-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OGDH was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 869-1023 of human OGDH (NP_002532.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against OGDH was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 869-1023 of human OGDH (NP_002532.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14796A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OGDH |
| Target Synonyms | E1k; E1o; KGD1; OGDC; AKGDH; OGDH2; OGDHD; OGDH-E1; OGDH | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Rat heart, MCF7, Mouse skeletal muscle | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 869-1023 of human OGDH (NP_002532.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RSSFDEMLPGTHFQRVIPEDGPAAQNPENVKRLLFCTGKVYYDLTRERKARDMVGQVAITRIEQLSPFPFDLLLKEVQKYPNAELAWCQEEHKNQGYYDYVKPRLRTTISRAKPVWYAGRDPAAAPATGNKKTHLTELQRLLDTAFDLDVFKNFS | Uniprot ID | Q02218 |
Uniprot Id
Q02218
Target Species
Human
Target Name
OGDH
Target Full Name
2-oxoglutarate dehydrogenase complex component E1
Target Function
2-oxoglutarate dehydrogenase (E1) component of the 2-oxoglutarate dehydrogenase complex (OGDHC), which mediates the decarboxylation of alpha-ketoglutarate. The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). The 2-oxoglutarate dehydrogenase complex is mainly active in the mitochondrion. A fraction of the 2-oxoglutarate dehydrogenase complex also localizes in the nucleus and is required for lysine succinylation of histones: associates with KAT2A on chromatin and provides succinyl-CoA to histone succinyltransferase KAT2A.
Target Subcellular Location
Mitochondrion matrix. Nucleus.
Target Protein Families
Alpha-ketoglutarate dehydrogenase family
Target Research Area
Metabolism
Target Synonyms
2 oxoglutarate dehydrogenase; 2 oxoglutarate dehydrogenase complex component E1; 2 oxoglutarate dehydrogenase mitochondrial; 2-oxoglutarate dehydrogenase; 2-oxoglutarate dehydrogenase complex component E1; AKGDH; Alpha ketoglutarate dehydrogenase ; Alpha-ketoglutarate dehydrogenase; E1k; mitochondrial; ODO1_HUMAN; OGDC; OGDC E1; OGDC-E1; OGDH; Oxoglutarate (alpha ketoglutarate) dehydrogenase (lipoamide); Oxoglutarate decarboxylase; Oxoglutarate dehydrogenase (lipoamide); Oxoglutarate dehydrogenase (succinyl transferring)
Target Background
This gene encodes one subunit of the 2-oxoglutarate dehydrogenase complex. This complex catalyzes the overall conversion of 2-oxoglutarate (alpha-ketoglutarate) to succinyl-CoA and CO(2) during the Krebs cycle. The protein is located in the mitochondrial matrix and uses thiamine pyrophosphate as a cofactor. A congenital deficiency in 2-oxoglutarate dehydrogenase activity is believed to lead to hypotonia, metabolic acidosis, and hyperlactatemia. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Notification