-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OGG1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 246-345 of human OGG1 (O15527) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against OGG1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 246-345 of human OGG1 (O15527) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16091A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OGG1 |
| Target Synonyms | HMMH; MUTM; OGH1; HOGG1; OGG1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HT-29, Mouse testis, U-251MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 246-345 of human OGG1 (O15527). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VGTKVADCICLMALDKPQAVPVDVHMWHIAQRDYSWHPTTSQAKGPSPQTNKELGNFFRSLWGPYAGWAQAVLFSADLRQSRHAQEPPAKRRKGSKGPEG | Uniprot ID | O15527 |
Uniprot Id
O15527
Target Species
Human
Target Name
OGG1
Target Full Name
N-glycosylase/DNA lyase
Target Function
DNA repair enzyme that incises DNA at 8-oxoG residues. Excises 7,8-dihydro-8-oxoguanine and 2,6-diamino-4-hydroxy-5-N-methylformamidopyrimidine (FAPY) from damaged DNA. Has a beta-lyase activity that nicks DNA 3' to the lesion.
Target Involvement
Renal cell carcinoma (RCC)
Target Subcellular Location
Nucleus, nucleoplasm. Nucleus speckle. Nucleus matrix. Note=Together with APEX1 is recruited to nuclear speckles in UVA-irradiated cells.; [Isoform 1A]: Nucleus.; [Isoform 2A]: Mitochondrion.
Target Protein Families
Type-1 OGG1 family
Target Tissue Specificity
Ubiquitous.
Target Research Area
Cancer
Target Synonyms
8 hydroxyguanine DNA glycosylase; 8 oxoguanine DNA glycosylase 1 ; 8 oxoguanine DNA glycosylase; AP lyase; DNA (apurinic or apyrimidinic site) lyase; DNA apurinic or apyrimidinic site lyase ; DNA lyase; DNA-(apurinic or apyrimidinic site) lyase; HMMH; HOGG 1; HOGG1; MMH; MUTM; N glycosylase; Ogg 1; Ogg1; OGG1_HUMAN; OGH 1; OGH1
Target Background
This gene encodes the enzyme responsible for the excision of 8-oxoguanine, a mutagenic base byproduct which occurs as a result of exposure to reactive oxygen. The action of this enzyme includes lyase activity for chain cleavage. Alternative splicing of the C-terminal region of this gene classifies splice variants into two major groups, type 1 and type 2, depending on the last exon of the sequence. Type 1 alternative splice variants end with exon 7 and type 2 end with exon 8. All variants share the N-terminal region in common, which contains a mitochondrial targeting signal that is essential for mitochondrial localization. Many alternative splice variants for this gene have been described, but the full-length nature for every variant has not been determined.
Notification