-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OLA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 130-310 of human OLA1 (NP_037473.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against OLA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 130-310 of human OLA1 (NP_037473.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-09212A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OLA1 |
| Target Synonyms | DOC45; GBP45; GTBP9; GTPBP9; PTD004; OLA1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, MCF7, Mouse brain, Mouse lung, Rat testis, U-251MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 130-310 of human OLA1 (NP_037473.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DDITHVEGSVDPIRDIEIIHEELQLKDEEMIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFT | Uniprot ID | Q9NTK5 |
Uniprot Id
Q9NTK5
Target Species
Human
Target Name
OLA1
Target Full Name
Obg-like ATPase 1
Target Function
Hydrolyzes ATP, and can also hydrolyze GTP with lower efficiency. Has lower affinity for GTP.
Target Subcellular Location
Cytoplasm. Nucleus. Nucleus, nucleolus.
Target Protein Families
TRAFAC class OBG-HflX-like GTPase superfamily, OBG GTPase family, YchF/OLA1 subfamily
Target Tissue Specificity
Expressed in all tissues tested but its expression is more abundant in testis, liver, lung, and brain. Overexpressed in several malignancies, including cancers of the colon, rectum, ovary, lung, stomach, and uterus.
Target Research Area
Signal Transduction
Target Synonyms
DKFZp313H1942; DNA damage-regulated overexpressed in cancer 45 protein; DOC45; EC 3.6.3; GBP45; GTP-binding protein 9 (putative); GTP-binding protein 9; GTP-binding protein PTD004; homologous yeast-44.2 protein; Obg like ATPase 1; Obg-like ATPase 1; OLA1; OLA1_HUMAN; PTD004
Target Background
This gene encodes a member of the GTPase protein family. The encoded protein interacts with breast cancer-associated gene 1 (BRCA1) and BRCA1-associated RING domain protein (BARD1), and is involved in centrosome regulation. Overexpression of this gene has been observed in multiple types of cancer and may be associated with poor survival. Pseudogenes of this gene have been defined on chromosomes 17 and 22.
Notification