Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Olig1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-271 of human Olig1 (NP_620450.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Olig1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-271 of human Olig1 (NP_620450.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02089A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OLIG1 |
| Target Synonyms | BHLHB6; BHLHE21; Olig1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 180-271 of human Olig1 (NP_620450.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GPAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPDALRPAKYLSLALDEPPCGQFALPGGGAGGPGLCTCAVCKFPHLVPASLGLAAVQAQFSK | Uniprot ID | Q8TAK6 |
Uniprot Id
Q8TAK6
Target Species
Human
Target Name
OLIG1
Target Full Name
Oligodendrocyte transcription factor 1
Target Function
Promotes formation and maturation of oligodendrocytes, especially within the brain. Cooperates with OLIG2 to establish the pMN domain of the embryonic neural tube.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Expressed in the brain, in oligodendrocytes. Strongly expressed in oligodendrogliomas, while expression is weak to moderate in astrocytomas. Expression in glioblastomas is highly variable.
Target Research Area
Neuroscience
Target Synonyms
Basic domain helix loop helix protein class B 6; Basic domain helix loop helix protein class B6; BHLH B6; BHLHB 6; bHLHb6; bHLHe21; Class B basic helix-loop-helix protein 6; Class E basic helix-loop-helix protein 21; Olig 1; Olig1; OLIG1_HUMAN; Oligo 1; Oligo1; Oligodendrocyte lineage transcription factor 1; Oligodendrocyte specific bHLH transcription factor 1; Oligodendrocyte transcription factor 1
Target Background
Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in neuron differentiation and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within neuron fate commitment. Predicted to be part of chromatin. Predicted to be active in nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
