Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Olig3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 173-272 of human Olig3 (Q7RTU3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Olig3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 173-272 of human Olig3 (Q7RTU3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14445A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OLIG3 |
| Target Synonyms | Bhlhb7; bHLHe20; OLIG3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-251 MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 173-272 of human Olig3 (Q7RTU3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HAANSVHPVHPILGGALSSGNASSPLSAASLPAIGTIRPPHSLLKAPSTPPALQLGSGFQHWAGLPCPCTICQMPPPPHLSALSTANMARLSAESKDLLK | Uniprot ID | Q7RTU3 |
Uniprot Id
Q7RTU3
Target Species
Human
Target Name
OLIG3
Target Full Name
Oligodendrocyte transcription factor 3
Target Function
May determine the distinct specification program of class A neurons in the dorsal part of the spinal cord and suppress specification of class B neurons.
Target Subcellular Location
Nucleus.
Target Synonyms
Basic helix loop helix domain containing class B protein 7; Basic helix-loop-helix domain-containing protein, class B, 7; bHLHB7; bHLHe20; Class B basic helix loop helix protein 7; Class B basic helix-loop-helix protein 7; Class E basic helix loop helix protein 20; Class E basic helix-loop-helix protein 20; Olig3; OLIG3_HUMAN; Oligo3; Oligodendrocyte lineage transcription factor 3; Oligodendrocyte specific bHLH transcription factor 3; Oligodendrocyte transcription factor 3
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
