-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OLR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human OLR1 (NP_002534.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against OLR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human OLR1 (NP_002534.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02152A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OLR1 |
| Target Synonyms | LOX1; LOXIN; SLOX1; CLEC8A; SCARE1; OLR1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human OLR1 (NP_002534.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESEN | Uniprot ID | P78380 |
Uniprot Id
P78380
Target Species
Human
Target Name
OLR1
Target Full Name
Oxidized low-density lipoprotein receptor 1
Target Function
Receptor that mediates the recognition, internalization and degradation of oxidatively modified low density lipoprotein (oxLDL) by vascular endothelial cells. OxLDL is a marker of atherosclerosis that induces vascular endothelial cell activation and dysfunction, resulting in pro-inflammatory responses, pro-oxidative conditions and apoptosis. Its association with oxLDL induces the activation of NF-kappa-B through an increased production of intracellular reactive oxygen and a variety of pro-atherogenic cellular responses including a reduction of nitric oxide (NO) release, monocyte adhesion and apoptosis. In addition to binding oxLDL, it acts as a receptor for the HSP70 protein involved in antigen cross-presentation to naive T-cells in dendritic cells, thereby participating in cell-mediated antigen cross-presentation. Also involved in inflammatory process, by acting as a leukocyte-adhesion molecule at the vascular interface in endotoxin-induced inflammation. Also acts as a receptor for advanced glycation end (AGE) products, activated platelets, monocytes, apoptotic cells and both Gram-negative and Gram-positive bacteria.
Target Involvement
Independent association genetic studies have implicated OLR1 gene variants in myocardial infarction susceptibility.; DISEASE: Note=OLR1 may be involved in Alzheimer disease (AD). Involvement in AD is however unclear: according to some authors (PubMed:12354387, PubMed:12810610 and PubMed:15976314), variations in OLR1 modify the risk of AD, while according to other (PubMed:15000751 and PubMed:15060104) they do not.
Target Subcellular Location
Cell membrane; Lipid-anchor. Cell membrane; Single-pass type II membrane protein. Membrane raft. Secreted. Note=A secreted form also exists. Localization to membrane rafts requires palmitoylation.
Target Tissue Specificity
Expressed at high level in endothelial cells and vascular-rich organs such as placenta, lung, liver and brain, aortic intima, bone marrow, spinal cord and substantia nigra. Also expressed at the surface of dendritic cells. Widely expressed at intermediate
Target Research Area
Cardiovascular
Target Synonyms
C-type lectin domain family 8 member A; CLEC8A; hLOX 1; hLOX-1; Lectin like oxidized LDL receptor 1; Lectin like oxLDL receptor 1; Lectin type oxidized LDL receptor 1; Lectin-like oxidized LDL receptor 1; Lectin-like oxLDL receptor 1; Lectin-type oxidized LDL receptor 1; low density lipoprotein oxidized, receptor 1; LOX-1; LOXIN; Olr1; OLR1_HUMAN; Ox LDL receptor 1; Ox-LDL receptor 1; Oxidised low density lipoprotein (lectin like) receptor 1; Oxidized low density lipoprotein receptor 1; Oxidized low density lipoprotein receptor 1 soluble form; Oxidized low-density lipoprotein receptor 1; OxLDL receptor 1 ; SCARE1; Scavenger receptor class E, member 1; SLOX1; soluble form; SR-EI
Target Background
This gene encodes a low density lipoprotein receptor that belongs to the C-type lectin superfamily. This gene is regulated through the cyclic AMP signaling pathway. The encoded protein binds, internalizes and degrades oxidized low-density lipoprotein. This protein may be involved in the regulation of Fas-induced apoptosis. This protein may play a role as a scavenger receptor. Mutations of this gene have been associated with atherosclerosis, risk of myocardial infarction, and may modify the risk of Alzheimer's disease. Alternate splicing results in multiple transcript variants.
Notification