Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OPA3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-179 of human OPA3 (NP_079412.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against OPA3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-179 of human OPA3 (NP_079412.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01829A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OPA3 |
| Target Synonyms | MGA3; OPA3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse eye, Rat eye | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 25-179 of human OPA3 (NP_079412.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NRIKEAARRSEFFKTYICLPPAQLYHWVEMRTKMRIMGFRGTVIKPLNEEAAAELGAELLGEATIFIVGGGCLVLEYWRHQAQQRHKEEEQRAAWNALRDEVGHLALALEALQAQVQAAPPQGALEELRTELQEVRAQLCNPGRSASHAVPASKK | Uniprot ID | Q9H6K4 |
Uniprot Id
Q9H6K4
Target Species
Human
Target Name
OPA3
Target Full Name
Optic atrophy 3 protein
Target Function
May play some role in mitochondrial processes.
Target Involvement
3-methylglutaconic aciduria 3 (MGA3); Optic atrophy 3 (OPA3)
Target Subcellular Location
Mitochondrion.
Target Protein Families
OPA3 family
Target Tissue Specificity
Ubiquitous. Most prominent expression in skeletal muscle and kidney.
Target Synonyms
OPA3; Optic atrophy 3 protein
Target Background
The mouse ortholog of this protein co-purifies with the mitochondrial inner membrane. Mutations in this gene have been shown to result in 3-methylglutaconic aciduria type III and autosomal dominant optic atrophy and cataract. Multiple transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
