Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OR10H3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human OR10H3 (NP_039227.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against OR10H3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human OR10H3 (NP_039227.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-06027A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OR10H3 |
| Target Synonyms | OR10H3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human OR10H3 (NP_039227.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLGLNHTSMSEFILVGFSAFPHLQLMLFLLFLLMYLFTLLGNLLIMATVWSERSLHTPMYLFLCVLSVSEILYTVAIIPRMLADLLSTQRSIAFLACASQ | Uniprot ID | O60404 |
Uniprot Id
O60404
Target Species
Human
Target Name
OR10H3
Target Full Name
Olfactory receptor 10H3
Target Synonyms
OR10H3; Olfactory receptor 10H3; Olfactory receptor OR19-24
Target Background
Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
