Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ORM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 35-201 of human ORM1 (NP_000598.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ORM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 35-201 of human ORM1 (NP_000598.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08581A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ORM1 |
| Target Synonyms | ORM; AGP1; A1AG1; AGP-A; HEL-S-153w; ORM1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | human serum, LO2, Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 35-201 of human ORM1 (NP_000598.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES | Uniprot ID | P02763 |
Uniprot Id
P02763
Target Species
Human
Target Name
ORM1
Target Full Name
Alpha-1-acid glycoprotein 1
Target Function
Functions as transport protein in the blood stream. Binds various ligands in the interior of its beta-barrel domain. Also binds synthetic drugs and influences their distribution and availability in the body. Appears to function in modulating the activity of the immune system during the acute-phase reaction.
Target Subcellular Location
Secreted.
Target Protein Families
Calycin superfamily, Lipocalin family
Target Tissue Specificity
Expressed by the liver and secreted in plasma.
Target Synonyms
ORM; AGP1; A1AG1; AGP-A; HEL-S-153w; ORM1
Target Background
This gene encodes a key acute phase plasma protein. Because of its increase due to acute inflammation, this protein is classified as an acute-phase reactant. The specific function of this protein has not yet been determined; however, it may be involved in aspects of immunosuppression.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
