Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OSTC was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human OSTC (NP_067050.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against OSTC was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human OSTC (NP_067050.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02303A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OSTC |
| Target Synonyms | DC2; OSTC | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293F, Mouse liver, Rat liver, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human OSTC (NP_067050.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YDVIVEPPSVGSMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKLPGYLMG | Uniprot ID | Q9NRP0 |
Uniprot Id
Q9NRP0
Target Species
Human
Target Name
OSTC
Target Full Name
Oligosaccharyltransferase complex subunit OSTC
Target Function
Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity. May be involved in N-glycosylation of APP (amyloid-beta precursor protein). Can modulate gamma-secretase cleavage of APP by enhancing endoprotelysis of PSEN1
Target Subcellular Location
Endoplasmic reticulum. Membrane; Multi-pass membrane protein.
Target Protein Families
OSTC family
Target Synonyms
OSTC; DC2; HDCMD45P; HSPC307; Oligosaccharyltransferase complex subunit OSTC; Hydrophobic protein HSF-28
Target Background
Predicted to contribute to dolichyl-diphosphooligosaccharide-protein glycotransferase activity. Predicted to be involved in protein N-linked glycosylation via asparagine. Part of oligosaccharyltransferase complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
