Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OTUB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-73 of human OTUB2 (NP_075601.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against OTUB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-73 of human OTUB2 (NP_075601.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10437A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OTUB2 |
| Target Synonyms | OTB2; OTU2; C14orf137; OTUB2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A549 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-73 of human OTUB2 (NP_075601.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSETSFNLISEKCDILSILRDHPENRIYRRKIEELSKRFTAIRKTKGDGNCFYRALGYSYLESLLGKSREIFK | Uniprot ID | Q96DC9 |
Uniprot Id
Q96DC9
Target Species
Human
Target Name
OTUB2
Target Full Name
Ubiquitin thioesterase OTUB2
Target Function
Hydrolase that can remove conjugated ubiquitin from proteins in vitro and may therefore play an important regulatory role at the level of protein turnover by preventing degradation. Mediates deubiquitination of 'Lys-11'-,'Lys-48'- and 'Lys-63'-linked polyubiquitin chains, with a preference for 'Lys-63'-linked polyubiquitin chains.
Target Protein Families
Peptidase C65 family
Target Tissue Specificity
Widely expressed. Expressed at higher level in brain.
Target Synonyms
C14orf137 ; Deubiquitinating enzyme OTUB2; FLJ21916; MGC3102; OTB2 ; OTU domain containing ubiquitin aldehyde binding protein 2; OTU domain, ubiquitin aldehyde binding 2; OTU domain-containing ubiquitin aldehyde-binding protein 2; OTU2 ; Otub2; OTUB2_HUMAN; Otubain 2; Otubain-2; Ubiquitin specific processing protease OTUB2; Ubiquitin specific protease otubain 2; Ubiquitin thioesterase OTUB2; Ubiquitin-specific-processing protease OTUB2
Target Background
This gene encodes one of several deubiquitylating enzymes. Ubiquitin modification of proteins is needed for their stability and function; to reverse the process, deubiquityling enzymes remove ubiquitin. This protein contains an OTU domain and binds Ubal (ubiquitin aldehyde); an active cysteine protease site is present in the OTU domain.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
