Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OVOL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human OVOL1 (NP_004552.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against OVOL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human OVOL1 (NP_004552.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05681A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OVOL1 |
| Target Synonyms | HOVO1; OVOL1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, Mouse lung, Mouse pancreas, Mouse testis, Rat thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human OVOL1 (NP_004552.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPRAFLVKKPCVSTCKRNWSELPDEERGEIYVPVSLGFCPPQPYREPEPSVAEPPSCPLALNMSLRDSSYSMAPGPCVVAQLPSEDMGHLTDPQSRDHGFLRTKMKVTLGDSPSGDLFTC | Uniprot ID | O14753 |
Uniprot Id
O14753
Target Species
Human
Target Name
OVOL1
Target Full Name
Putative transcription factor Ovo-like 1
Target Function
Putative transcription factor. Involved in hair formation and spermatogenesis. May function in the differentiation and/or maintenance of the urogenital system.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Expressed in fetal kidney, and also in adult pancreas and placenta. Not expressed in intestine, peripheral blood lymphocytes and ovary.
Target Synonyms
hOvo1; Ovo homolog like 1; Ovo like 1(Drosophila); Ovo, Drosophila, homolog-like, 1; Ovol1; OVOL1_HUMAN; Putative transcription factor Ovo like 1; Putative transcription factor Ovo-like 1
Target Background
This gene encodes a putative zinc finger containing transcription factor that is highly similar to homologous protein in Drosophila and mouse. Based on known functions in these species, this protein is likely involved in hair formation and spermatogenesis in human as well.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
