Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OX40L was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 51-183 of human OX40L (NP_003317.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against OX40L was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 51-183 of human OX40L (NP_003317.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07275A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OX40L |
| Target Synonyms | GP34; CD252; OX4OL; TXGP1; CD134L; OX-40L; TNLG2B; OX40L | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Hep G2, HepG2, Mouse spleen, Mouse thymus, PC-3, Raji | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 51-183 of human OX40L (NP_003317.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL | Uniprot ID | P23510 |
Uniprot Id
P23510
Target Species
Human
Target Name
TNFSF4
Target Full Name
Tumor necrosis factor ligand superfamily member 4
Target Function
Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.
Target Involvement
Systemic lupus erythematosus (SLE)
Target Subcellular Location
Membrane; Single-pass type II membrane protein.
Target Protein Families
Tumor necrosis factor family
Target Synonyms
TNFSF4; TXGP1; Tumor necrosis factor ligand superfamily member 4; Glycoprotein Gp34; OX40 ligand; OX40L; TAX transcriptionally-activated glycoprotein 1; CD antigen CD252
Target Background
This gene encodes a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene have been associated with Sjogren's syndrome and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
