-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OXGR1 / GPR99 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human OXGR1 / GPR99 (Q96P68) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against OXGR1 / GPR99 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human OXGR1 / GPR99 (Q96P68) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13401A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OXGR1 / GPR99 |
| Target Synonyms | aKGR; GPR80; GPR99; P2Y15; P2RY15; OXGR1 / GPR99 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat kidney | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human OXGR1 / GPR99 (Q96P68). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AVVACAVVWIISLVAVIPMTFLITSTNRTNRSACLDLTSSDELNTIKWYNLILTATTFCLPLVIVTLCYTTIIHTLTHGLQTDSCLKQKARRLTILLLLAF | Uniprot ID | Q96P68 |
Uniprot Id
Q96P68
Target Species
Human
Target Name
OXGR1
Target Full Name
2-oxoglutarate receptor 1
Target Function
Receptor for alpha-ketoglutarate. Seems to act exclusively through a G(q)-mediated pathway.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Detected in kidney and, to a lower extent, in placenta. Not detected in brain tissues including the frontal cortex, caudate putamen, thalamus, hypothalamus, hippocampus or pons.
Target Synonyms
OXGR1; GPR80; GPR99; P2RY15; P2Y15; 2-oxoglutarate receptor 1; Alpha-ketoglutarate receptor 1; G-protein coupled receptor 80; G-protein coupled receptor 99; P2Y purinoceptor 15; P2Y-like GPCR; P2Y-like nucleotide receptor
Target Background
This gene encodes a G protein-coupled receptor (GPCR) that belongs to the oxoglutarate receptor family within the GPCR superfamily. The encoded protein is activated by the citric acid intermediate, oxoglutarate, as well as several cysteinyl leukotrienes, including leukotrienes E4, C4 and D4, which are implicated in many inflammatory disorders. In mice, a knock-out of this gene leads to middle ear inflammation, changes in the mucosal epithelium, and an increase in fluid behind the eardrum, and is associated with hearing loss. Alternative splicing results in multiple transcript variants.
Notification