Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against P2RY1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 274-373 of human P2RY1 (NP_002554.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against P2RY1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 274-373 of human P2RY1 (NP_002554.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02370A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | P2RY1 |
| Target Synonyms | P2Y1; SARCC; P2RY1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 22Rv1, Rat intestine, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 274-373 of human P2RY1 (NP_002554.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IPFHVMKTMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDTSL | Uniprot ID | P47900 |
Uniprot Id
P47900
Target Species
Human
Target Name
P2RY1
Target Full Name
P2Y purinoceptor 1
Target Function
Receptor for extracellular adenine nucleotides such as ADP. In platelets, binding to ADP leads to mobilization of intracellular calcium ions via activation of phospholipase C, a change in platelet shape, and ultimately platelet aggregation.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
P2RY1; P2Y purinoceptor 1; P2Y1; ADP receptor; Purinergic receptor
Target Background
The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor functions as a receptor for extracellular ATP and ADP. In platelets binding to ADP leads to mobilization of intracellular calcium ions via activation of phospholipase C, a change in platelet shape, and probably to platelet aggregation.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
