-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against P4HA3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human P4HA3 (NP_878907.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against P4HA3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human P4HA3 (NP_878907.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11455A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | P4HA3 |
| Target Synonyms | P4HA3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human P4HA3 (NP_878907.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DPERAAARGDTFSALTSVARALAPERRLLGLLRRYLRGEEARLRDLTRFYDKVLSLHEDSTTPVANPLLAFTLIKRLQSDWRNVVHSLEAS | Uniprot ID | Q7Z4N8 |
Uniprot Id
Q7Z4N8
Target Species
Human
Target Name
P4HA3
Target Full Name
Prolyl 4-hydroxylase subunit alpha-3
Target Function
Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in collagens and other proteins.
Target Subcellular Location
Endoplasmic reticulum lumen.
Target Protein Families
P4HA family
Target Tissue Specificity
Highly expressed in placenta, liver and fetal skin. Weakly expressed in fetal epiphyseal cartilage, fetal liver, fibroblast, lung and skeletal muscle. Expressed also in fibrous cap of carotid atherosclerotic lesions.
Target Research Area
Signal Transduction
Target Synonyms
2-oxoglutarate-4-dioxygenase subunit alpha-3; 4-PH alpha-3; P4ha3; P4HA3_HUMAN; Procollagen-proline; Procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), alpha polypeptide III; Procollagen-proline, 2-oxoglutarate 4-dioxygenase, alpha subunit, isoform 3; Procollagen-proline,2-oxoglutarate-4-dioxygenase subunit alpha-3; Prolyl 4-hydroxylase subunit alpha-3; Prolyl 4-hydroxylase, alpha polypeptide III; Prolyl 4-hydroxylase, alpha-3 subunit
Target Background
This gene encodes a component of prolyl 4-hydroxylase, a key enzyme in collagen synthesis composed of two identical alpha subunits and two beta subunits. The encoded protein is one of several different types of alpha subunits and provides the major part of the catalytic site of the active enzyme. In collagen and related proteins, prolyl 4-hydroxylase catalyzes the formation of 4-hydroxyproline that is essential to the proper three-dimensional folding of newly synthesized procollagen chains. Alternative splicing results in multiple transcript variants.
Notification