-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against p60 CAF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 459-559 of human p60 CAF1 (Q13112) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against p60 CAF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 459-559 of human p60 CAF1 (Q13112) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13935A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | p60 CAF1 |
| Target Synonyms | CAF1; MPP7; CAF-1; CAF1A; CAF1P60; CAF-IP60; MPHOSPH7; p60 CAF1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Jurkat | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 459-559 of human p60 CAF1 (Q13112). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PLPGPSEEKTLQPSSQNTKAHPSRRVTLNTLQAWSKTTPRRINLTPLKTDTPPSSVPTSVISTPSTEEIQSETPGDAQGSPPELKRPRLDENKGGTESLDP | Uniprot ID | Q13112 |
Uniprot Id
Q13112
Target Species
Human
Target Name
CHAF1B
Target Full Name
Chromatin assembly factor 1 subunit B
Target Function
Complex that is thought to mediate chromatin assembly in DNA replication and DNA repair. Assembles histone octamers onto replicating DNA in vitro. CAF-1 performs the first step of the nucleosome assembly process, bringing newly synthesized histones H3 and H4 to replicating DNA; histones H2A/H2B can bind to this chromatin precursor subsequent to DNA replication to complete the histone octamer.
Target Subcellular Location
Nucleus. Cytoplasm. Note=DNA replication foci. Cytoplasmic in M phase.
Target Protein Families
WD repeat HIR1 family
Target Synonyms
CAF 1 subunit B; CAF 1A; CAF I 60 kDa subunit; CAF IP60; CAF-1; CAF-1 subunit B; CAF-I 60 kDa subunit; CAF-I p60; CAF1; CAF1A; CAF1B_HUMAN; CAF1P60; CHAF 1B; CHAF1B; Chromatin assembly factor 1 subunit B; Chromatin assembly factor I; Chromatin assembly factor I p60 subunit; Human chromatin assembly factor-I p60 subunit; M phase phosphoprotein 7; M-phase phosphoprotein 7; MPHOSPH7; MPP 7; MPP7; p60 subunit
Target Background
Chromatin assembly factor I (CAF-I) is required for the assembly of histone octamers onto newly-replicated DNA. CAF-I is composed of three protein subunits, p50, p60, and p150. The protein encoded by this gene corresponds to the p60 subunit and is required for chromatin assembly after replication. The encoded protein is differentially phosphorylated in a cell cycle-dependent manner. In addition, it is normally found in the nucleus except during mitosis, when it is released into the cytoplasm. This protein is a member of the WD-repeat HIR1 family and may also be involved in DNA repair.
Notification