-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against p70 S6 Kinase 2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human p70 S6 Kinase 2 (Q9UBS0) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against p70 S6 Kinase 2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human p70 S6 Kinase 2 (Q9UBS0) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14204A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | p70 S6 Kinase 2 |
| Target Synonyms | KLS; SRK; S6K2; S6KB; STK14B; S6KI(2); S6Kbeta; p70S6Kb; P70-beta; S6K-beta2; P70-beta-1; P70-beta-2; p70(S6K)-beta; p70 S6 Kinase 2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human p70 S6 Kinase 2 (Q9UBS0). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPERIGPHCFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRAER | Uniprot ID | Q9UBS0 |
Uniprot Id
Q9UBS0
Target Species
Human
Target Name
RPS6KB2
Target Full Name
Ribosomal protein S6 kinase beta-2
Target Function
Phosphorylates specifically ribosomal protein S6. Seems to act downstream of mTOR signaling in response to growth factors and nutrients to promote cell proliferation, cell growth and cell cycle progression in an alternative pathway regulated by MEAK7.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Protein kinase superfamily, AGC Ser/Thr protein kinase family, S6 kinase subfamily
Target Research Area
Signal Transduction
Target Synonyms
70 kDa ribosomal protein S6 kinase 2; EC 2.7.11.1; KS6B2_HUMAN; p70 beta; p70 ribosomal S6 kinase beta; p70 S6 kinase beta; p70 S6K-beta; p70 S6KB; p70 S6Kbeta; p70(S6K) beta; p70-beta; p70-S6K 2; P70S6K2; p70S6Kb; Ribosomal protein S6 kinase 70kDa; polypeptide 2; Ribosomal protein S6 kinase B2; Ribosomal protein S6 kinase beta 2; Ribosomal protein S6 kinase beta-2; Rps6kb2; S6 kinase related kinase; S6 kinase-related kinase; S6K beta 2; S6K beta; S6K-beta; S6K-beta-2; S6K2; Serine/threonine protein kinase 14 beta ; Serine/threonine-protein kinase 14B; SRK; STK14B
Target Background
This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains a kinase catalytic domain and phosphorylates the S6 ribosomal protein and eukaryotic translation initiation factor 4B (eIF4B). Phosphorylation of S6 leads to an increase in protein synthesis and cell proliferation.
Notification