-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PACS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 420-560 of human PACS1 (NP_060496.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PACS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 420-560 of human PACS1 (NP_060496.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03174A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PACS1 |
| Target Synonyms | SHMS; MRD17; PACS1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 420-560 of human PACS1 (NP_060496.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SKGSLGKDTTSPMELAALEKIKSTWIKNQDDSLTETDTLEITDQDMFGDASTSLVVPEKVKTPMKSSKTDLQGSASPSKVEGVHTPRQKRSTPLKERQLSKPLSERTNSSDSERSPDLGHSTQIPRKVVYDQLNQILVSDA | Uniprot ID | Q6VY07 |
Uniprot Id
Q6VY07
Target Species
Human
Target Name
PACS1
Target Full Name
Phosphofurin acidic cluster sorting protein 1
Target Function
Coat protein that is involved in the localization of trans-Golgi network (TGN) membrane proteins that contain acidic cluster sorting motifs. Controls the endosome-to-Golgi trafficking of furin and mannose-6-phosphate receptor by connecting the acidic-cluster-containing cytoplasmic domain of these molecules with the adapter-protein complex-1 (AP-1) of endosomal clathrin-coated membrane pits. Involved in HIV-1 nef-mediated removal of MHC-I from the cell surface to the TGN.
Target Involvement
Schuurs-Hoeijmakers syndrome (SHMS)
Target Subcellular Location
Golgi apparatus, trans-Golgi network.
Target Protein Families
PACS family
Target Synonyms
Cytosolic sorting protein PACS1; PACS 1; PACS-1; Pacs1; PACS1_HUMAN; Phosphofurin acidic cluster sorting protein 1
Target Background
This gene encodes a protein with a putative role in the localization of trans-Golgi network (TGN) membrane proteins. Mouse and rat homologs have been identified and studies of the homologous rat protein indicate a role in directing TGN localization of furin by binding to the protease's phosphorylated cytosolic domain. In addition, the human protein plays a role in HIV-1 Nef-mediated downregulation of cell surface MHC-I molecules to the TGN, thereby enabling HIV-1 to escape immune surveillance.
Notification