-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PACSIN2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 240-410 of human PACSIN2 (NP_009160.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PACSIN2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 240-410 of human PACSIN2 (NP_009160.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01947A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PACSIN2 |
| Target Synonyms | SDPII; PACSIN2 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 240-410 of human PACSIN2 (NP_009160.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RLRFFREVLLEVQKHLDLSNVAGYKAIYHDLEQSIRAADAVEDLRWFRANHGPGMAMNWPQFEEWSADLNRTLSRREKKKATDGVTLTGINQTGDQSLPSKPSSTLNVPSNPAQSAQSQSSYNPFEDEDDTGSTVSEKDDTKAKNVSSYEKTQSYPTDWSDDESNNPFSST | Uniprot ID | Q9UNF0 |
Uniprot Id
Q9UNF0
Target Species
Human
Target Name
PACSIN2
Target Full Name
Protein kinase C and casein kinase substrate in neurons protein 2
Target Function
Regulates the morphogenesis and endocytosis of caveolae. Lipid-binding protein that is able to promote the tubulation of the phosphatidic acid-containing membranes it preferentially binds. Plays a role in intracellular vesicle-mediated transport. Involved in the endocytosis of cell-surface receptors like the EGF receptor, contributing to its internalization in the absence of EGF stimulus.; (Microbial infection) Specifically enhances the efficiency of HIV-1 virion spread by cell-to-cell transfer. Also promotes the protrusion engulfment during cell-to-cell spread of bacterial pathogens like Listeria monocytogenes. Involved in lipid droplet formation, which is important for HCV virion assembly.
Target Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton. Cytoplasmic vesicle membrane; Peripheral membrane protein; Cytoplasmic side. Early endosome. Recycling endosome membrane. Cell projection, ruffle membrane; Peripheral membrane protein; Cytoplasmic side. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cell projection. Membrane, caveola. Note=Detected at the neck of flask-shaped caveolae. Localization to tubular recycling endosomes probably requires interaction with MICALL1 and EHD1.
Target Protein Families
PACSIN family
Target Tissue Specificity
Widely expressed.
Target Synonyms
cytoplasmic phosphoprotein PACSIN2; OTTHUMP00000198281; OTTHUMP00000198282; OTTHUMP00000198283; OTTHUMP00000198284; PACN2_HUMAN; Pacsin2; protein kinase C and casein kinase substrate in neurons 2 ; Protein kinase C and casein kinase substrate in neurons protein 2; SDPII; Syndapin II
Target Background
This gene is a member of the protein kinase C and casein kinase substrate in neurons family. The encoded protein is involved in linking the actin cytoskeleton with vesicle formation by regulating tubulin polymerization. Alternative splicing results in multiple transcript variants.
Notification