-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PADI2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human PADI2 (NP_031391.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PADI2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human PADI2 (NP_031391.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02261A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PADI2 |
| Target Synonyms | PAD2; PDI2; PAD-H19; PADI2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, HT-29, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human PADI2 (NP_031391.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSEHVWVEVVRDGEAEEVATNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQAGLFLTAIEISLDVDADRDGVVEKNNPKKASWTWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSKEDLKDMSQMILRTKGPDRLPAGYEI | Uniprot ID | Q9Y2J8 |
Uniprot Id
Q9Y2J8
Target Species
Human
Target Name
PADI2
Target Full Name
Protein-arginine deiminase type-2
Target Function
Catalyzes the deimination of arginine residues of proteins.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Protein arginine deiminase family
Target Tissue Specificity
Detected in keratinocytes in epidermis (at protein level).
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
KIAA0994; OTTHUMP00000044625; PAD 2; PAD H19 ; PAD-H19; PAD2; PADI 2; Padi2; PADI2 protein; PADI2_HUMAN; PDI 2; PDI2; Peptidlyarginine deiminase type II; Peptidyl arginine deiminase II; Peptidyl arginine deiminase type II; Peptidylarginine deiminase II; Protein arginine deiminase; Protein arginine deiminase type 2; Protein arginine deiminase type II; Protein-arginine deiminase type II; Protein-arginine deiminase type-2
Target Background
This gene encodes a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post-translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. The family members have distinct substrate specificities and tissue-specific expression patterns. The type II enzyme is the most widely expressed family member. Known substrates for this enzyme include myelin basic protein in the central nervous system and vimentin in skeletal muscle and macrophages. This enzyme is thought to play a role in the onset and progression of neurodegenerative human disorders, including Alzheimer disease and multiple sclerosis, and it has also been implicated in glaucoma pathogenesis. This gene exists in a cluster with four other paralogous genes.
Notification